First Scientific Proof Of God Found

Message boards : Politics : First Scientific Proof Of God Found
Message board moderation

To post messages, you must log in.

Previous · 1 . . . 13 · 14 · 15 · 16 · 17 · Next

AuthorMessage
Profile Bernie Vine
Volunteer moderator
Volunteer tester
Avatar

Send message
Joined: 26 May 99
Posts: 9954
Credit: 103,452,613
RAC: 328
United Kingdom
Message 1550928 - Posted: 1 Aug 2014, 13:17:58 UTC

I took it to mean that the previous post was "as clear as mud"

I sentiment I echo.
ID: 1550928 · Report as offensive
brendan
Avatar

Send message
Joined: 2 Sep 99
Posts: 165
Credit: 7,294,631
RAC: 0
United States
Message 1551034 - Posted: 1 Aug 2014, 17:58:29 UTC - in response to Message 1546443.  

Here's the amino-acid sequence for human insulin from the GenBank database. Can you show us how to convert this into the appropriate quote from the bible?

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Cheers.

Brendan,
Short answer - No, I can't. I cannot decode it. I need someone who is willing to work with me to help me extract the sequences. And so far, I haven't found anyone willing to help me.

I have a tonne of sequences already written out, by hand. But I lack the computer programming skills to know how to decode the stuff in reverse.

Its simple, but cracking the code is NOT simple. And you need to run the correct sequences, with NO spelling mistakes. And your only going to get them from ME!! I'm the only one who knows what sequences to search for. There is an inherent problem involved in cracking the code. And someone will have to "teach" you "how" to do it. You won't get it by pot-luck, or chancing your arm. You need to know the method, and its complex.

There are 20 amino acids, and 26 letters in the English alphabet. You have to know "how" they were writing the words down 2000 years ago, you MUST get an "original text". A modern printed bible in English is no good to you, you need one of the hand-written originals. 20 to the power of 26 is a massive number, its an astronomically large number. That is how many different possible letters you would have to swap around just to get one single letter in the right place. Then you have to repeat that 19 more times to get the full code.

It might look like this if you cracked the code;
Amino acid single letter abbreviation;
A, B, C, D, E, F, G......etc, etc, ... (Just a fictitious example)
What the Bible used;
W, N, E, M, B, R, T......etc, etc, ...(Just a fictitious example)

But of coarse, as I said, I haven't cracked the code YET! But i'm almost there.

It sounds simple to just swap the letters around. But its actually quite difficult when you try.

There is also another way to get the code. If you spend 10 years of your life becoming an expert in the old religious texts, the code is actually written out in one of the old books. But I don't know which book they wrote it out in. It might be coded into the Bible, or it might not, I don't know, i'm not a Bible expert. But I do have another book that I think has part of the code written out, but i'm still working on that book. The book is very old, and its difficult to read, and its not written in english.

John.

So, you claim there is a code, but no one actually has the code. So, basically, there is no code. Given the massive computing power already applied to analyzing the human genome, I think we would have already uncovered hidden messages. So basically you are pedalling a bunch of nonsense wrapped up with a bit of pseudoscience gleaned by having heard of ENCODE and Pubmed etc. Give it a rest.
ID: 1551034 · Report as offensive
Sirius B Project Donor
Volunteer tester
Avatar

Send message
Joined: 26 Dec 00
Posts: 24879
Credit: 3,081,182
RAC: 7
Ireland
Message 1551037 - Posted: 1 Aug 2014, 18:00:16 UTC - in response to Message 1551034.  

Give it a rest.


Which? the code or his fingers?
ID: 1551037 · Report as offensive
brendan
Avatar

Send message
Joined: 2 Sep 99
Posts: 165
Credit: 7,294,631
RAC: 0
United States
Message 1551056 - Posted: 1 Aug 2014, 18:44:40 UTC - in response to Message 1551037.  

Give it a rest.


Which? the code or his fingers?


Preferably both.
ID: 1551056 · Report as offensive
LanDroid

Send message
Joined: 23 Jun 99
Posts: 2
Credit: 1,619,667
RAC: 0
United States
Message 1551269 - Posted: 2 Aug 2014, 3:58:51 UTC

Johnney Guinness said If you spend 10 years of your life becoming an expert in the old religious texts, the code is actually written out in one of the old books. But I don't know which book they wrote it out in.

Sorry, had to quote that again to giggle while scratchin' me head...

But of coarse {sic}, as I said, I haven't cracked the code YET! But i'm almost there.

Perhaps just one word will help:
Apophenia
ap·o·phe·nia noun \ˌa-pə-ˈfē-nē-ə\
Psychology: the tendency to perceive a connection or meaningful pattern between unrelated or random things (such as objects or ideas).

"Another thing we will not address here, are any of the theories that suggest that ghosts are nothing more than refracted light, low frequency vibrations, or simply just some form of apophenia."
— Jim Griffin, How to Survive an Alien Abduction: And Other Useful Information, 2008

"The promise of the Data Age is that the truth really is in there, somewhere. But our age has a curse, too: apophenia, the tendency to see patterns that may or may not exist."
— Daniel Conover, Post and Courier (Charleston, South Carolina), 30 Aug. 2004

http://www.merriam-webster.com/dictionary/apophenia
ID: 1551269 · Report as offensive
Profile Johnney Guinness
Volunteer tester
Avatar

Send message
Joined: 11 Sep 06
Posts: 3093
Credit: 2,652,287
RAC: 0
Ireland
Message 1551329 - Posted: 2 Aug 2014, 6:48:44 UTC - in response to Message 1551034.  
Last modified: 2 Aug 2014, 6:59:53 UTC

So, you claim there is a code, but no one actually has the code. So, basically, there is no code. Given the massive computing power already applied to analyzing the human genome, I think we would have already uncovered hidden messages. So basically you are pedalling a bunch of nonsense wrapped up with a bit of pseudoscience gleaned by having heard of ENCODE and Pubmed etc. Give it a rest.

Brendan,
There are a few hundred messages posted into this thread since it started. And Brendan, your the ONLY person that has actually asked an intelligent question about the science I have discussed in this thread. Brendan your the only person who seems to have an understanding of molecular biology and genetics.

Therefore Brendan, your the only person here capable of understanding just how complex the science of genetic engineering really is. Therefore Brendan, you should also understand that there is really no reason why any scientist working in genetics would want to swap the letters around in the amino acid code!!! Brendan, why would any scientist do it? Why would any genetic engineer even think about swapping the letters around? There is no reason to do it!! Its the last thing any genetic engineer would think of doing. And that is why the code I am telling you about still hasn't been found!! Nobody has found the code because nobody is looking for it!!

Brendan, are you interested in helping me crack the code? Send me a private message if your interested in working on cracking the code.

John.
ID: 1551329 · Report as offensive
Profile ML1
Volunteer moderator
Volunteer tester

Send message
Joined: 25 Nov 01
Posts: 20291
Credit: 7,508,002
RAC: 20
United Kingdom
Message 1551505 - Posted: 2 Aug 2014, 18:15:03 UTC - in response to Message 1551329.  
Last modified: 2 Aug 2014, 18:17:34 UTC

... There are a few hundred messages posted into this thread since it started...

Yes, an amazing yarn...


... the ONLY person that has actually asked an intelligent question about the science I have discussed in this thread...

Hey! So what about the rest of us?

So far, no Science seen other than "complex dreams" of Bible code "somehow hidden" in science articles... All another conspiracy theory spin?...


... just how complex the science of genetic engineering really is. ... there is really no reason why any scientist working in genetics would want to swap the letters around in the amino acid code!!!

"Complex" is not a description or any excuse for describing something as "Science". Note that Science strives for the simplest explanation and solution. 'Complexity' is in no way any excuse for anything in Science.

As for the naming: Note that we use Human names that are completely arbitrary for the language used. For example, the letters used to describe genetics could well have been something completely different had some language other than Latin prevailed as the lingua-franca of academics.

Or can you somehow claim there is a single language of some or all gods despite the story of the Tower of Babylon?


...Nobody has found the code because nobody is looking for it!!

Are you searching for something real or are you merely chasing gold at the end of a rainbow?


So, for your quest:

Are the same texts to be found in all DNA and by using the same consistent method?

Is that same code to be found in all cells?

Why?



Or... More Guinness?

The real test is to write the first chapter of your book!


Keep searchin',
Martin
See new freedom: Mageia Linux
Take a look for yourself: Linux Format
The Future is what We all make IT (GPLv3)
ID: 1551505 · Report as offensive
Profile KC5VDJ - Jim the Enchanter
Avatar

Send message
Joined: 17 May 99
Posts: 81
Credit: 4,083,597
RAC: 0
United States
Message 1551643 - Posted: 2 Aug 2014, 23:20:56 UTC - in response to Message 1533168.  

"Linguistic professors at Bob Jones University, long noted for its intellectual rigor"

This is pure parody.

I may post it on facebook and see how many of the christian extremist insurrectionists go for it. I bet all the Bubbas will!
Delidded i7-4790K (CLU/CLU) at 4.7GHz @ 1.310Vcore 24/7, 32GB DDR3-2400, Corsair H100i v2, Gigabyte Z97X-Gaming G1 WIFI-BK, MSI Radeon RX 480 Gaming 4G, HX-650 PSU, Corsair 750D

ID: 1551643 · Report as offensive
Profile ML1
Volunteer moderator
Volunteer tester

Send message
Joined: 25 Nov 01
Posts: 20291
Credit: 7,508,002
RAC: 20
United Kingdom
Message 1551676 - Posted: 3 Aug 2014, 0:29:26 UTC - in response to Message 1551505.  

Or can you somehow claim there is a single language of some or all gods despite the story of the Tower of Babylon?

Oooops! That should read "Babel"...


Now, where is that Douglas Adams' Babel fish?...

Keep searchin',
Martin
See new freedom: Mageia Linux
Take a look for yourself: Linux Format
The Future is what We all make IT (GPLv3)
ID: 1551676 · Report as offensive
Batter Up
Avatar

Send message
Joined: 5 May 99
Posts: 1946
Credit: 24,860,347
RAC: 0
United States
Message 1551677 - Posted: 3 Aug 2014, 0:34:24 UTC - in response to Message 1551643.  

I may post it on facebook and see how many of the christian extremist insurrectionists go for it. I bet all the Bubbas will!
There are several Facebook pages on this as well as scores of supposed forums.
This site claimes it’s satire, and that WIT is not a real place. Not sure, but I’d be highly skeptical.
There are many evidences of God, for those willing to reason. All of creation speaks of God.

Could that be true that the WIT does not exist? How can that be as they are on the Interweb with a logo. IMHO it is an Atheist religion smear tactic.

ID: 1551677 · Report as offensive
Profile Wiggo
Avatar

Send message
Joined: 24 Jan 00
Posts: 34766
Credit: 261,360,520
RAC: 489
Australia
Message 1551680 - Posted: 3 Aug 2014, 0:44:30 UTC - in response to Message 1551677.  

I may post it on facebook and see how many of the christian extremist insurrectionists go for it. I bet all the Bubbas will!
There are several Facebook pages on this as well as scores of supposed forums.
This site claimes it’s satire, and that WIT is not a real place. Not sure, but I’d be highly skeptical.
There are many evidences of God, for those willing to reason. All of creation speaks of God.

Could that be true that the WIT does not exist? How can that be as they are on the Interweb with a logo. IMHO it is an Atheist religion smear tactic.

Maybe you should've read the the 4th post in this thread Battered Up. ;-)

Cheers.
ID: 1551680 · Report as offensive
Profile betreger Project Donor
Avatar

Send message
Joined: 29 Jun 99
Posts: 11361
Credit: 29,581,041
RAC: 66
United States
Message 1551685 - Posted: 3 Aug 2014, 1:11:04 UTC

I think we need a new thread called comedy.
Johnny has always been one of the best. I have really enjoyed these pious and correct rebutals of this farce.
ID: 1551685 · Report as offensive
Profile William Rothamel
Avatar

Send message
Joined: 25 Oct 06
Posts: 3756
Credit: 1,999,735
RAC: 4
United States
Message 1551693 - Posted: 3 Aug 2014, 2:02:18 UTC - in response to Message 1551680.  
Last modified: 3 Aug 2014, 2:02:57 UTC

I prefer the Sam Houston Institute of Technology !!

Actually it's true that I once guest lectured at the Stevens Hoboken Institute of Technology. It was in Hoboken (New Jersey) but not usually part of their name
ID: 1551693 · Report as offensive
Profile Byron Leigh Hatch @ team Carl Sagan
Volunteer tester
Avatar

Send message
Joined: 5 Jul 99
Posts: 4548
Credit: 35,667,570
RAC: 4
Canada
Message 1551699 - Posted: 3 Aug 2014, 2:29:38 UTC - in response to Message 1551680.  
Last modified: 3 Aug 2014, 2:45:43 UTC

I may post it on facebook and see how many of the christian extremist insurrectionists go for it. I bet all the Bubbas will!
There are several Facebook pages on this as well as scores of supposed forums.
This site claimes it’s satire, and that WIT is not a real place. Not sure, but I’d be highly skeptical.
There are many evidences of God, for those willing to reason. All of creation speaks of God.

Could that be true that the WIT does not exist? How can that be as they are on the Interweb with a logo. IMHO it is an Atheist religion smear tactic.

Maybe you should've read the the 4th post in this thread Battered Up. ;-)

Cheers.

Hi Wiggo, your post is Very good. thank you!

Wiggo Posted the following in:

Message 1533183 - Posted: 28 Jun 2014, 11:56:16 UTC

Wyoming Institute of Technology is owned by Corinthian Colleges, Inc. in which both are under legal investigations on both state and federal levels in the USA.

Also are the authors of the "Solar panels drain the sun’s energy" claim and the "1 in 3 Americans Implanted With RFID Chips" claim.

They even made the Ripoff Report.

So I'll put them in the same category Intelligent Design and Creationism and take what ever is published by them with a pinch of salt.

Cheers.
Wiggo

Hi Wiggo, your post is Very good. thank you!

Best Wishes
Byron
ID: 1551699 · Report as offensive
Profile Johnney Guinness
Volunteer tester
Avatar

Send message
Joined: 11 Sep 06
Posts: 3093
Credit: 2,652,287
RAC: 0
Ireland
Message 1551805 - Posted: 3 Aug 2014, 11:37:35 UTC - in response to Message 1551505.  
Last modified: 3 Aug 2014, 11:40:37 UTC

ML1 wrote:
Are the same texts to be found in all DNA and by using the same consistent method?

Is that same code to be found in all cells?

Martin,
Short answer - Yes. There is DNA in all living things. Some of the DNA makes proteins, and the rest of the DNA is an instruction set to "build" that specific living thing. Its the same code in people, animals, birds, fish, trees, plants, bacteria, etc, etc...

Read "Central dogma of molecular biology";
http://en.wikipedia.org/wiki/Central_dogma_of_molecular_biology

Why?

Martin,
Because that is how living things work.

The real test is to write the first chapter of your book!

Maybe Martin, maybe I will write it out in a book. Maybe if I get time.

John.
ID: 1551805 · Report as offensive
Profile ML1
Volunteer moderator
Volunteer tester

Send message
Joined: 25 Nov 01
Posts: 20291
Credit: 7,508,002
RAC: 20
United Kingdom
Message 1551821 - Posted: 3 Aug 2014, 12:57:41 UTC - in response to Message 1551805.  

...maybe I will write it out in a book. Maybe if I get time.



If you have the will, and you have the conviction of Truth, then you will have the time.

You never know, you may gain your own following and cult...!

Could keep you in Guinness forever!! :-)


Keep searchin',
Martin
See new freedom: Mageia Linux
Take a look for yourself: Linux Format
The Future is what We all make IT (GPLv3)
ID: 1551821 · Report as offensive
Profile Johnney Guinness
Volunteer tester
Avatar

Send message
Joined: 11 Sep 06
Posts: 3093
Credit: 2,652,287
RAC: 0
Ireland
Message 1551833 - Posted: 3 Aug 2014, 13:19:32 UTC - in response to Message 1551821.  

...maybe I will write it out in a book. Maybe if I get time.



If you have the will, and you have the conviction of Truth, then you will have the time.

You never know, you may gain your own following and cult...!

Could keep you in Guinness forever!! :-)


Keep searchin',
Martin

Martin,
If I did write it out in a book, it wouldn't be for money. I'm not motivated by money. I will think about it.

John.
ID: 1551833 · Report as offensive
brendan
Avatar

Send message
Joined: 2 Sep 99
Posts: 165
Credit: 7,294,631
RAC: 0
United States
Message 1552055 - Posted: 4 Aug 2014, 2:26:47 UTC - in response to Message 1551329.  

So, you claim there is a code, but no one actually has the code. So, basically, there is no code. Given the massive computing power already applied to analyzing the human genome, I think we would have already uncovered hidden messages. So basically you are pedalling a bunch of nonsense wrapped up with a bit of pseudoscience gleaned by having heard of ENCODE and Pubmed etc. Give it a rest.

Brendan,
There are a few hundred messages posted into this thread since it started. And Brendan, your the ONLY person that has actually asked an intelligent question about the science I have discussed in this thread. Brendan your the only person who seems to have an understanding of molecular biology and genetics.

Therefore Brendan, your the only person here capable of understanding just how complex the science of genetic engineering really is. Therefore Brendan, you should also understand that there is really no reason why any scientist working in genetics would want to swap the letters around in the amino acid code!!! Brendan, why would any scientist do it? Why would any genetic engineer even think about swapping the letters around? There is no reason to do it!! Its the last thing any genetic engineer would think of doing. And that is why the code I am telling you about still hasn't been found!! Nobody has found the code because nobody is looking for it!!

Brendan, are you interested in helping me crack the code? Send me a private message if your interested in working on cracking the code.

John.


John, there's no code. No message. No bible in your DNA. Its just some crazy idea you have. Complex algorithms are used daily to look for repeating patterns in DNA. If there was a hidden code, we would have found it. And it doesn't matter if you swap the letters around. Math would find the repetitive signatures you predict. We haven't found them. They are not there.
ID: 1552055 · Report as offensive
Batter Up
Avatar

Send message
Joined: 5 May 99
Posts: 1946
Credit: 24,860,347
RAC: 0
United States
Message 1552070 - Posted: 4 Aug 2014, 3:07:58 UTC

What's up with DNA and g-d? Your Spiritual DNA (Written By: Joel Osteen). He is not just the all-powerful God. He is your Heavenly Father. You have His DNA. Imagine what you can do!
I should have had DNA testing done then G-d would have had to pay my child support.
ID: 1552070 · Report as offensive
Profile ML1
Volunteer moderator
Volunteer tester

Send message
Joined: 25 Nov 01
Posts: 20291
Credit: 7,508,002
RAC: 20
United Kingdom
Message 1552142 - Posted: 4 Aug 2014, 9:11:35 UTC - in response to Message 1552055.  
Last modified: 4 Aug 2014, 9:12:04 UTC

... No bible in your DNA. Its just some crazy idea you have. Complex algorithms are used daily to look for repeating patterns in DNA. If there was a hidden code, we would have found it. And it doesn't matter if you swap the letters around. Math would find the repetitive signatures you predict. We haven't found them. They are not there.

I have to agree on various counts.

And note there are various searches being done continuously by such as SIMAP.


Regardless, there is great scope there for a book of some sort, even without any science ;-)

Keep searchin',
Martin
See new freedom: Mageia Linux
Take a look for yourself: Linux Format
The Future is what We all make IT (GPLv3)
ID: 1552142 · Report as offensive
Previous · 1 . . . 13 · 14 · 15 · 16 · 17 · Next

Message boards : Politics : First Scientific Proof Of God Found


 
©2024 University of California
 
SETI@home and Astropulse are funded by grants from the National Science Foundation, NASA, and donations from SETI@home volunteers. AstroPulse is funded in part by the NSF through grant AST-0307956.