Message boards :
Politics :
First Scientific Proof Of God Found
Message board moderation
Previous · 1 . . . 11 · 12 · 13 · 14 · 15 · 16 · 17 · Next
Author | Message |
---|---|
Sirius B Send message Joined: 26 Dec 00 Posts: 24879 Credit: 3,081,182 RAC: 7 |
Walked right into that one :-( |
Terror Australis Send message Joined: 14 Feb 04 Posts: 1817 Credit: 262,693,308 RAC: 44 |
Because I bother to follow links that people post, I found this one on the Witscience site Johnnie, are you sure that site is "for real" and you haven't been suckered in by a satire site ? Liberalism Caused By Defective Chromosome [edit] The author of this article is listed as Dr. Richter DasMeerungeheuer, which according to Google, translates as "Judge The sea monster" ??? [/edit] T.A. |
Terror Australis Send message Joined: 14 Feb 04 Posts: 1817 Credit: 262,693,308 RAC: 44 |
The punch line of the story was, that when they finally decoded the sequence, it turned out to be a copyright notice. :) Boom, Tish :D BTW. In the story, the name of the copyright holder was not revealed. :) T.A. |
anniet Send message Joined: 2 Feb 14 Posts: 7105 Credit: 1,577,368 RAC: 75 |
Because I bother to follow links that people post, I found this one on the Witscience site Yes! I googled him awhile back! Did you like their conclusive study on wind turbines slowing the earth's rotation? :) edit: I googled the expert who wrote that, and came up with a stone that is not shiny (or something to that effect) :) |
Johnney Guinness Send message Joined: 11 Sep 06 Posts: 3093 Credit: 2,652,287 RAC: 0 |
Because I bother to follow links that people post, I found this one on the Witscience site Terror Australis, Yes, I agree with you, its a satire website! All the articles are complete rubbish. But here is the thing - I opened this thread by linking to the article called "First Scientific Proof Of God Found", which is also written as satire. But Terror Australis, its NOT satire. The article is different to the other articles on the website. Its intentional!!! And its not an accident that they put that article on a satirical website. There is stuff in that article that they simply COULD NOT HAVE KNOWN!! They name specific genes, specifically they mention PYGB and Bmp3. Now Terror Australis, I know those genes don't mean anything to you. But I know exactly what they were talking about because I have been studying genetics for 4 years now. And they specifically tell you where to look for the sequence. They tell you its the verse from "1 Corinthians 6:19-20". They say stuff in the article that only someone with experience in genetic engineering could know. All you need is a computer, a head for mathematics, and an interest in genetic engineering, and some time on your hands to go investigate!! The Sanger Institute in Britain is one of the worlds foremost and respected scientific institute's carrying out genetics research. They have a copy of the human genome on their website, and its free for anyone to go and download and carry out research. https://www.sanger.ac.uk/ Terror Australis, I dare you!! Go and check it. Go and attempt to decode the sequences. But to do it, you will need a reasonable understanding of genetics and mathematics. All you got to do is swap around the letters of the amino acid code we use today, its that simple!! And out pops the Christian Bible from the human genome. But I warn you, it will take you a few months to get the code right! But you could get lucky and crack it sooner! If you take the offer seriously, I will help you. I have tonnes of sequences already written out! John. |
Johnney Guinness Send message Joined: 11 Sep 06 Posts: 3093 Credit: 2,652,287 RAC: 0 |
Batter Up, Batter Up, That's a great biblical quote. I took a note of it for future reference! (In case the white coat men try to put the straight-jacket on me the next time :) ) Batter Up, can I ask you a question? You seem to have a considerable knowledge of the Bible, do you read it? Also; I see you not writing the name of G-d. Only specific people do this Batter up. Somebody taught you to do that, and you obviously still do it? It shows a certain respect for religion. Or do you have another reason for doing it? http://www.jewfaq.org/name.htm John. |
Johnney Guinness Send message Joined: 11 Sep 06 Posts: 3093 Credit: 2,652,287 RAC: 0 |
Batter Up, anniet, You said "drunk in Eve's womb"! So at least somebody here is reading what I write. And remembering it. Anniet, have I influenced your thinking at all, do you think? While the things I say are a bit mad, do you think that, maybe, in a very theoretical world, there might be a tiny bit of truth in what I suggest? John. |
Julie Send message Joined: 28 Oct 09 Posts: 34053 Credit: 18,883,157 RAC: 18 |
The punch line of the story was, that when they finally decoded the sequence, it turned out to be a copyright notice. :) You mean God?;) @ Johnney: I understand what you're trying to explain here but I'd give up thinking anybody would really understand or is rather willing to understand you here. As I read before in this thread, quite an eccentric board here and everybody has his or her own ideas... Always nice to discuss thing in a civilized manner though, can't deny that... rOZZ Music Pictures |
ML1 Send message Joined: 25 Nov 01 Posts: 20289 Credit: 7,508,002 RAC: 20 |
... I understand what you're trying to explain here but I'd give up thinking anybody would really understand or is rather willing to understand you here. As I read before in this thread, quite an eccentric board here and everybody has his or her own ideas... Always nice to discuss thing in a civilized manner though, can't deny that... Fascinating to see how religions and conspiracy theories work! And good fun for a good yarn... Next: Philosophy? ;-) Keep searchin', Martin See new freedom: Mageia Linux Take a look for yourself: Linux Format The Future is what We all make IT (GPLv3) |
Julie Send message Joined: 28 Oct 09 Posts: 34053 Credit: 18,883,157 RAC: 18 |
|
anniet Send message Joined: 2 Feb 14 Posts: 7105 Credit: 1,577,368 RAC: 75 |
anniet, John! Hi :) Well the bible says Noah was in a tent I think, but this is YOUR thread and we are discussing your theories, so "womb" seemed more apt in the circumstances, particularly as I was referring to a time after the flood had already washed him and the ark down Eve's fallopian tubes. So at least somebody here is reading what I write. And remembering it. I most certainly am remembering it :) Anniet, have I influenced your thinking at all, do you think? Well... I think you've convinced me more than ever that trying to make sense of a book written over a thousand years ago - and prove it's validity in anything other than an allegorical sense in our modern scientific world requires some very prolonged and tortuous thinking. I commend you on yours! :) While the things I say are a bit mad, do you think that, maybe, in a very theoretical world, there might be a tiny bit of truth in what I suggest? I do think that what you are saying does seem a tad... off the wall... shall we say :) but then I have come to conclude the same about so much of the bible itself, that I don't see why your version should not also be out there for the whole world to know about either :) John, I hope you don't mind me asking the following? I thought I had already seen it somewhere in one of your posts, but I haven't been able to find it. At which point in the bible does Eve give birth? ps: sorry I haven't yet been able to answer your post in your other thread :( I hope to find some time to do so later today :) |
Batter Up Send message Joined: 5 May 99 Posts: 1946 Credit: 24,860,347 RAC: 0 |
At which point in the bible does Eve give birth? Genesis 4 And Adam knew Eve his wife; and she conceived, and bare Cain, and said, I have gotten a man from Yahweh. |
anniet Send message Joined: 2 Feb 14 Posts: 7105 Credit: 1,577,368 RAC: 75 |
At which point in the bible does Eve give birth? That's what I thought! But... this IS Johnney's thread... :) |
Batter Up Send message Joined: 5 May 99 Posts: 1946 Credit: 24,860,347 RAC: 0 |
Oh sorry; you were testing him. Carry on.At which point in the bible does Eve give birth? |
Julie Send message Joined: 28 Oct 09 Posts: 34053 Credit: 18,883,157 RAC: 18 |
Oh sorry; you were testing him. Carry on.At which point in the bible does Eve give birth? I don't think she was. rOZZ Music Pictures |
Sirius B Send message Joined: 26 Dec 00 Posts: 24879 Credit: 3,081,182 RAC: 7 |
At which point in the bible does Eve give birth? You mean god wanted to sample the forbidden fruit for himself? |
Batter Up Send message Joined: 5 May 99 Posts: 1946 Credit: 24,860,347 RAC: 0 |
At which point in the bible does Eve give birth? It was most likely one of the Nephilim. Genesis 6:4 |
brendan Send message Joined: 2 Sep 99 Posts: 165 Credit: 7,294,631 RAC: 0 |
Here's the amino-acid sequence for human insulin from the GenBank database. Can you show us how to convert this into the appropriate quote from the bible? MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN Cheers. |
Johnney Guinness Send message Joined: 11 Sep 06 Posts: 3093 Credit: 2,652,287 RAC: 0 |
Here's the amino-acid sequence for human insulin from the GenBank database. Can you show us how to convert this into the appropriate quote from the bible? Brendan, Short answer - No, I can't. I cannot decode it. I need someone who is willing to work with me to help me extract the sequences. And so far, I haven't found anyone willing to help me. I have a tonne of sequences already written out, by hand. But I lack the computer programming skills to know how to decode the stuff in reverse. Its simple, but cracking the code is NOT simple. And you need to run the correct sequences, with NO spelling mistakes. And your only going to get them from ME!! I'm the only one who knows what sequences to search for. There is an inherent problem involved in cracking the code. And someone will have to "teach" you "how" to do it. You won't get it by pot-luck, or chancing your arm. You need to know the method, and its complex. There are 20 amino acids, and 26 letters in the English alphabet. You have to know "how" they were writing the words down 2000 years ago, you MUST get an "original text". A modern printed bible in English is no good to you, you need one of the hand-written originals. 20 to the power of 26 is a massive number, its an astronomically large number. That is how many different possible letters you would have to swap around just to get one single letter in the right place. Then you have to repeat that 19 more times to get the full code. It might look like this if you cracked the code; Amino acid single letter abbreviation; A, B, C, D, E, F, G......etc, etc, ... (Just a fictitious example) What the Bible used; W, N, E, M, B, R, T......etc, etc, ...(Just a fictitious example) But of coarse, as I said, I haven't cracked the code YET! But i'm almost there. It sounds simple to just swap the letters around. But its actually quite difficult when you try. There is also another way to get the code. If you spend 10 years of your life becoming an expert in the old religious texts, the code is actually written out in one of the old books. But I don't know which book they wrote it out in. It might be coded into the Bible, or it might not, I don't know, i'm not a Bible expert. But I do have another book that I think has part of the code written out, but i'm still working on that book. The book is very old, and its difficult to read, and its not written in english. John. |
William Rothamel Send message Joined: 25 Oct 06 Posts: 3756 Credit: 1,999,735 RAC: 4 |
It sounds simple to just swap the letters around. But its actually quite difficult when you try. Au Contraire' Mon Herr It would be a cinch. A computer could run every possible substitution on, say, a sentence and then match it with a computerized copy of the bible, the human genome or whatever you say is encoded. It would then quickly reject the many mismatches until it found that sentence intact. Then to verify your theory you would use the substitution that was successful on the next sentence and of course it would match as well if what you say is true. Todays supercomputers at Lawrence Livermore can do 1,000,000,000,000,000,000 instructions per second so it shouldn't take too long at all. It would be a rather simple program at that. You of course would have to specify in which language that you found this remarkable discovery. Early accounts of the Bible were written in Greek. I presume you are talking about the New Testament. There are only 3 billion pairs in the human genome so probably a random match of a long sentence might be possible but not the entire text. As you can see my alter ego Daddio has also made significant breakthroughs in this important field. |
©2024 University of California
SETI@home and Astropulse are funded by grants from the National Science Foundation, NASA, and donations from SETI@home volunteers. AstroPulse is funded in part by the NSF through grant AST-0307956.