Posts by Johnney Guinness

21) Message boards : Politics : First Scientific Proof Of God Found (Message 1546514)
Posted 23 Jul 2014 by Profile Johnney Guinness
Post:
you need one of the hand-written originals


As I pointed out by linking you to Bart Ehrman's research, there are no original texts. Only copies of copies, and they were changing constantly.

I know you only looked at two minutes of each video, so you didn't get the evidence. This is true for both the old and new testaments. Bart looked at the oldest texts in existence, then the newer ones to develop a time line of what was added and when. Many times he can even explain why.

The Old Testament had at least 40 different authors, and was written over 1600 years. The new testament had thousands of authors, and evolved as church leaders tried to explain the inconsistencies and differences. It didn't even become a Bible until about 300 years after the time Jesus was alive.

There was so much evidence you passed up, because you only saw two minutes of each video, and decided you didn't like what you heard.

Steve

Steve,
I know that you are personally following a particular line of inquiry in your own Bible research. But Steve, i'm doing something very different to you, and its very different to Bart Ehrman. I tried to explain it to you, but I think you kind of breezed over the post I made and didn't really understand the importance of what I had written.

However, thank you Steve. Yes, I agree that Bart Ehrman's work is indeed very interesting. Its just different to what I am doing.

John.
22) Message boards : Politics : First Scientific Proof Of God Found (Message 1546499)
Posted 23 Jul 2014 by Profile Johnney Guinness
Post:
It sounds simple to just swap the letters around. But its actually quite difficult when you try.


Au Contraire' Mon Herr

It would be a cinch. A computer could run every possible substitution on, say, a sentence and then match it with a computerized copy of the bible or whatever you say is encoded. It would then quickly reject the many mismatches until it found that sentence intact. Then to verify your theory you would use the substitution that was successful on the next sentence and of course it would match as well if what you say is true. Todays supercomputers at Lawrence Livermore can do 1,000,000,000,000,000,000 instructions per second so it shouldn't take too long at all. It would be a rather simple program at that.

You of course would have to specify which language that you found this remarkable discovery.

Early accounts of the Bible were written in Greek. I presume you are talking about the New Testiment.

Daddio,
Therein lies the problem. Do you happen to have the phone number of Lawrence Livermore labs and I will just give them a quick call.

This is what I will say to them;
"Hi Guys. I was hanging out on an Extraterrestrial Alien hunting forum and I accidently found God. So would you guys mind if I use your billion dollar computer to search the human genome to see if I can find messages from God."

Yep, i'm pretty sure the guys at Lawrence Livermore Labs would just love to help me. Or more likely, they would try to put a straight-jacket on me and get me locked up.

John.
23) Message boards : Politics : First Scientific Proof Of God Found (Message 1546443)
Posted 23 Jul 2014 by Profile Johnney Guinness
Post:
Here's the amino-acid sequence for human insulin from the GenBank database. Can you show us how to convert this into the appropriate quote from the bible?

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Cheers.

Brendan,
Short answer - No, I can't. I cannot decode it. I need someone who is willing to work with me to help me extract the sequences. And so far, I haven't found anyone willing to help me.

I have a tonne of sequences already written out, by hand. But I lack the computer programming skills to know how to decode the stuff in reverse.

Its simple, but cracking the code is NOT simple. And you need to run the correct sequences, with NO spelling mistakes. And your only going to get them from ME!! I'm the only one who knows what sequences to search for. There is an inherent problem involved in cracking the code. And someone will have to "teach" you "how" to do it. You won't get it by pot-luck, or chancing your arm. You need to know the method, and its complex.

There are 20 amino acids, and 26 letters in the English alphabet. You have to know "how" they were writing the words down 2000 years ago, you MUST get an "original text". A modern printed bible in English is no good to you, you need one of the hand-written originals. 20 to the power of 26 is a massive number, its an astronomically large number. That is how many different possible letters you would have to swap around just to get one single letter in the right place. Then you have to repeat that 19 more times to get the full code.

It might look like this if you cracked the code;
Amino acid single letter abbreviation;
A, B, C, D, E, F, G......etc, etc, ... (Just a fictitious example)
What the Bible used;
W, N, E, M, B, R, T......etc, etc, ...(Just a fictitious example)

But of coarse, as I said, I haven't cracked the code YET! But i'm almost there.

It sounds simple to just swap the letters around. But its actually quite difficult when you try.

There is also another way to get the code. If you spend 10 years of your life becoming an expert in the old religious texts, the code is actually written out in one of the old books. But I don't know which book they wrote it out in. It might be coded into the Bible, or it might not, I don't know, i'm not a Bible expert. But I do have another book that I think has part of the code written out, but i'm still working on that book. The book is very old, and its difficult to read, and its not written in english.

John.
24) Message boards : Politics : How I learned about God - David C. Pack (Message 1546429)
Posted 23 Jul 2014 by Profile Johnney Guinness
Post:
Anniet,
Let me just save you some time and I can clarify this whole issue for you very quickly.

Anniet, the following is a typical video made by the Restored Church of God and David C. Pack.

Video name; December 21, 2012 is NOT the End of the World!
https://www.youtube.com/watch?v=v90IB-MPDUo (30 minutes long!)

It was a video made by the Restored Church of God and published on Youtube 3 months before the whole world-wide hype about the world ending in December 21st, 2012. In the video, David, C. Pack tries to teach Christians that they have absolutely nothing to worry about.

Anniet, you can watch the whole 30 minute video if you want, but I can save you some time.

Please fast forward the video to 8 minutes into it, just to save you time.
And just watch 1 minute 40 of the video. Watch from 8 minutes into the video to 9 minutes 40 seconds.

Anniet, what I want to highlight is what David C. Pack says at exactly 8 minutes 45 seconds into the video. At that point in the video David C. Pack quotes his favourite quote from the Bible, which is;

Matthew 25:13(NIV)
“Therefore keep watch, because you do not know the day or the hour."
https://www.biblegateway.com/passage/?search=Matthew+25%3A13&version=NIV

Now Anniet, like I said to you already, I have watched all 170 videos they have on Youtube. And the one thing that David C. Pack NEVER DOES is predict dates for the End of the World!

Anniet, he NEVER does it, never!! He never predicts dates of the End of the World, never, ever, ever. Why??? Answer, because he always, always, always quotes Matthew 25:13 and tells you the words of Jesus Christ, which are “Therefore keep watch, because you do not know the day or the hour."

Matthew 25:13 is David C. Packs favourite quote from the Bible. its in all his videos!

So Anniet, i'm quite sure that your not man (or woman) enough to apologise. I'm quite sure you will continue to stand you ground and you will continue to defend the propaganda website you linked to. That is probably your nature Anniet.

Makes me wonder why you read the Bible 4 or 5 times Anniet? You didn't seem to learn anything from reading it.

John.
25) Message boards : Politics : How I learned about God - David C. Pack (Message 1545949)
Posted 22 Jul 2014 by Profile Johnney Guinness
Post:
....

No matter. If you'd followed the links I posted it would have set your mind at rest as to the date being from Mr Pack himself (in a leaked member letter provided to the silenced website by someone who was once just like you - one of Mr Pack's followers - as are many who have contributed to the exit and support network). But as you don't give credence to internet sites (other than: youtube, the RCG website, and Witscience of course) your dismissal will I know, continue, so I won't belabour the point :)

The basis for some of his calculations I believe can be found here David C. Pack and the 3 ½ years It seems there is or was a mention in one of his mp3 audio file downloads, but with something like 450 of them to wade through, I have not tracked it down for you. I will take your word for it that he is not "promoting" it in his videos though. :) They are of course, harder to edit than the written word.

I do grant you that Mr Pack has not made the same quantity of prophetical gaffes as Ron Weinland of the RCG's sister church (or splinter group) the COG... whose most recently revised armageddon date (given from inside his prison cell) is Pentecost 2019 - which gives us all an extra three years! :)

I will and do defend the exit and support network though. It is not written as you say by "some spammer with a grudge".

This could be... and this too.. Restored Church of God Members Deceived Into Thinking David C. Pack Never Set Any Dates. And as for his suspected involvement in events surrounding the death of a four year old girl and her mother's subsequent suicide attempt (and three other suicides that occurred during what has been called his "Reign of Terror" whilst serving his mentor Herbert Armstrong) detailed in the Ambassador Report... thay make for very disturbing reading.

There are SO many more Johnney :( I do hope they're all wrong...

Anniet,
You were unable to give me a link to any video or webpage on a David C. Pack website, or a Restored Church of God website that states an exact date for the End of the World. So Anniet, I think I have proven my point!! Anniet, you posted a message stating as a matter of fact that David C. Pack was promoting a particular date for the End of the World. If he was Anniet, wouldn't you be able to find that webpage, or video, or book, or anything? Maybe i'm telling you the truth Anniet. Maybe he doesn't promote dates for the End of the World.

Anniet, have some dignity and stand down. Apologise for making false statements about he man. Your trying desperately to discredit a very nice man that tries his best to teach people the Bible. He tries his best Anniet, you could learn from him.

John.
26) Message boards : Politics : First Scientific Proof Of God Found (Message 1545473)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
Batter Up,
The next time the guys in the white coats start chasing me through the park because i'm stark nakid and reading the Bible, I'm going to quote your words!


Not the words of Batter Up but the word of g-d.
Isaiah 20:2
... "Go and loosen the sackcloth from your hips and take your shoes off your feet." And he did so, going naked and barefoot.


Yep - Noah did a bit of that (Genesis 9:20-25) whilst he was drunk in Eve's womb I think.

Edit: THINK that's on topic...

anniet,
You said "drunk in Eve's womb"!

So at least somebody here is reading what I write. And remembering it.

Anniet, have I influenced your thinking at all, do you think?
While the things I say are a bit mad, do you think that, maybe, in a very theoretical world, there might be a tiny bit of truth in what I suggest?

John.
27) Message boards : Politics : First Scientific Proof Of God Found (Message 1545462)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
Batter Up,
The next time the guys in the white coats start chasing me through the park because i'm stark nakid and reading the Bible, I'm going to quote your words!


Not the words of Batter Up but the word of g-d.
Isaiah 20:2
... "Go and loosen the sackcloth from your hips and take your shoes off your feet." And he did so, going naked and barefoot.

Batter Up,
That's a great biblical quote. I took a note of it for future reference! (In case the white coat men try to put the straight-jacket on me the next time :) )

Batter Up, can I ask you a question?
You seem to have a considerable knowledge of the Bible, do you read it?
Also;
I see you not writing the name of G-d. Only specific people do this Batter up. Somebody taught you to do that, and you obviously still do it? It shows a certain respect for religion. Or do you have another reason for doing it? http://www.jewfaq.org/name.htm

John.
28) Message boards : Politics : How I learned about God - David C. Pack (Message 1545450)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
Sirius B,
What book did you read? Is it America & Britain in Prophesy? I'm ashamed to say, but I only got through about half the book. I only read the bit up until the point where David C. Pack explains how the thrown of King David passes through 3 Kingdoms.

I quit the book after that. That was the bit wanted to read. So I don't know what he said about the Eagle and the lion symbols.

Ah, so you cherry picked. Next time, try reading the whole book.

Sirius B,
Like I said, I only read the first half of the book. I just wanted to find out what he said about Ireland, and the High Kings of Ireland. I was just curious.

But you got to admit, its an interesting read! Gripping stuff!

John.
29) Message boards : Politics : How I learned about God - David C. Pack (Message 1545447)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
Gee thanks Anniet, how can I ever repay you for saving me from the vicious religious cult that is run by a power hunger demon who just wants everybody's money?

You're welcome Johnney.

Have you a paypal account Anniet, I can forward you some cash to thank you.

No. I don't trust the internet :) and I'm not in the habit of taking money from anyone - gullible or not. Do I presume your rapid unconversion from Pack's teachings is why you didn't answer my question?

If September 27, 2016 passes by without a hitch - will you accept yet another revised doomsday date?

anniet,
The website is run by someone with a grudge against David C. Pack. so no, I don't trust a single word written on the website.

anniet show me a webpage, or a video, by David C. Pack, or the Restored Church of God, that says that he is promoting that date as the date for the end of the world.

anniet I have watched all 170 videos on there Youtube channel, and David C. Pack does not give dates for the End of the World in any single one of the videos. Not a single one Anniet! However - He does "discuss" the end of the world in many of the videos. He does what the Bible tells you to do. the "Bible" tells you the world is going to end. Its not David C. Pack, its the Bible says it!! David c. Pack is just reading exactly what the bible tells him to tell other people. He is telling people the Word of God.

Annite, show me a page in the RCG website where that date is listed as the date for the end of the world!

It doesn't matter if some spammer with a grudge wrote it some place else on the internet.

John.
30) Message boards : Politics : First Scientific Proof Of God Found (Message 1545440)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
Because I bother to follow links that people post, I found this one on the Witscience site

Johnnie, are you sure that site is "for real" and you haven't been suckered in by a satire site ?

Liberalism Caused By Defective Chromosome

[edit] The author of this article is listed as Dr. Richter DasMeerungeheuer, which according to Google, translates as "Judge The sea monster" ??? [/edit]

T.A.

Terror Australis,
Yes, I agree with you, its a satire website! All the articles are complete rubbish.

But here is the thing - I opened this thread by linking to the article called "First Scientific Proof Of God Found", which is also written as satire.

But Terror Australis, its NOT satire. The article is different to the other articles on the website. Its intentional!!! And its not an accident that they put that article on a satirical website.

There is stuff in that article that they simply COULD NOT HAVE KNOWN!! They name specific genes, specifically they mention PYGB and Bmp3. Now Terror Australis, I know those genes don't mean anything to you. But I know exactly what they were talking about because I have been studying genetics for 4 years now. And they specifically tell you where to look for the sequence. They tell you its the verse from "1 Corinthians 6:19-20". They say stuff in the article that only someone with experience in genetic engineering could know.

All you need is a computer, a head for mathematics, and an interest in genetic engineering, and some time on your hands to go investigate!!

The Sanger Institute in Britain is one of the worlds foremost and respected scientific institute's carrying out genetics research. They have a copy of the human genome on their website, and its free for anyone to go and download and carry out research. https://www.sanger.ac.uk/

Terror Australis, I dare you!! Go and check it. Go and attempt to decode the sequences. But to do it, you will need a reasonable understanding of genetics and mathematics. All you got to do is swap around the letters of the amino acid code we use today, its that simple!! And out pops the Christian Bible from the human genome. But I warn you, it will take you a few months to get the code right! But you could get lucky and crack it sooner!

If you take the offer seriously, I will help you. I have tonnes of sequences already written out!

John.
31) Message boards : Politics : How I learned about God - David C. Pack (Message 1545239)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:

There is absolutely no sane response to this... Really it sounds like a bad Clive Barker novel or something. Oh well, have fun with your religious racist friends/con artist out for your money.

Michelle,
Hang on, don't leave just yet!

Do you not want to have another go at me? Common, surely you can think up some more good stuff about David Pack and the Restored Church of God?

If you can't think of something sane to say, then say something that is insane! Go on, you know you want to! I can take it!

John.
32) Message boards : Politics : How I learned about God - David C. Pack (Message 1545227)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
David C. Pack is my Teacher, my Rabbi, and he has shown me the way to the Light of God's Kingdom. I am very thankful to him.

Information on The Restored Church of God and David C. Pack that you may not have had time to find for yourself.

And... ...in case you ever need it

May God bless and protect David C. Pack and give him his rightful place in the coming Kingdom of God that will arrive on Earth very soon.

David Pack's prophecies

September 27, 2016 is the um... revised apocalyptic date because... well... because the others must've been off a bit. (Last failure: 19th May 2013)

Okay. Now... you might find the following link upsetting Johnney (particularly the further down the page you get) so don't click on it unless you wish to hear some of the testimonies from RCG members who know David Pack personally. I am including it because as Мишель said:

Don't need to personally know the guy, his actions and publicly stated beliefs say enough about him and his church.

Restored Church of God

I am not in any way attempting to undermine your faith and religious beliefs, so please don't shout at me :) Former "victims" (as they see themselves) of RCG (and other splinter groups that formed alongside it) kept their faith in Christianity and it's teachings after leaving this "cult" (as they call it) much much poorer then when they joined it adnittedly, but that's neither here nor there. Not one of them continues to give credence to David C Pack's claims that he is a prophet.

If September 27, 2016 passes by without a hitch - will you accept yet another revised doomsday date?

Anniet,
Well somebody went to a lot of trouble building those websites and writing out all that stuff. Well done Anniet for finding the websites and the articles. Sounds like somebody has a real bad grudge against David C. Pack. And judging by the content of the articles, the person sounds pretty gullible, and is left with a bad taste in their mouth after being stung.

Yep, it definitely sounds like I have been sucked into a religious cult. That is what the websites call the Restored Church of God, they call it a cult! Well Anniet, if they say its a cult, then it must be a cult so, isn't that right? It says so right there on the internet, so it must be true? There is no way they would make stuff up and then put it on a website on the internet.

Gee Anniet, sounds like you saved me from the nightmare of a vicious religious cult that sucks people in just to get their money of them!! Wow, I was blind and now I know the real truth, because I read it on that really super website. Wow, I feel enlightened Anniet now that you have educated me about religious cults claiming that God done it all.

Gee thanks Anniet, how can I ever repay you for saving me from the vicious religious cult that is run by a power hunger demon who just wants everybody's money?

Have you a paypal account Anniet, I can forward you some cash to thank you.

John.
33) Message boards : Politics : How I learned about God - David C. Pack (Message 1545213)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
Okay, I've read the book. Can't find much difference between that & what Jehovah's witnesses have stated over the years regarding the Eagle & the Lion.

Let's look at the Eagle & the Lion & the time period. America & Britain? Really?

The period that Jesus lived through was the Roman Empire...

The Aquila

"Marius later made the eagle (aquila) the supreme symbol because of its association with the god Jupiter."

...and what of the lion?

Staying in the same time period, we have the Lion as the ultimate symbol as a test of Christianity's faith.

Another way of looking at it is that authors (unless some futuristic Sci-Fi novel) write their stories around the times they live in.

Move forward 2000 years & not much as changed...

...any lions in Mosul?

Sirius B,
What book did you read? Is it America & Britain in Prophesy? I'm ashamed to say, but I only got through about half the book. I only read the bit up until the point where David C. Pack explains how the thrown of King David passes through 3 Kingdoms. First the royal bloodline of King David is passed forward from Israel through his daughter Tea-Tephi, who is taken by the Biblical Prophet Jeremiah to Egypt, then on to Ireland where she marries into the line of the High Kings of Ireland. Then the royal blood line is uprooted again and moves to Scotland. And then again a third time, the royal bloodline is uprooted again and moved down to England, where it is still there today in the royal bloodline of Queen Elizabeth II.

I quit the book after that. That was the bit wanted to read. So I don't know what he said about the Eagle and the lion symbols.

John.
34) Message boards : Politics : How I learned about God - David C. Pack (Message 1545207)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
Michelle,
Someone isn't a racist just because they don't see the world through your eyes. A person isn't racist because they want to fall in love and marry another person from the same ethnic background as themselves. This is simply human nature for a person to chose to marry someone who is from the same ethnic background. Its not racist!

Nope, its not racist to fall in love on people of your own ethnicity. It becomes racists once you do that because you believe that you need to keep your own race 'pure'. It becomes racist when you are not allowed by others to marry outside your ethnicity because those others believe in racial purity. This churches motives are racist and therefor they are racist.

As for you Michelle, you accused David C. Pack of being, and I quote, a "racist bigot who thinks the EU is run by the Anti-Christ".

Now that is just bang out of order! You don't even know the man. And you are calling him terrible names and saying terrible things about the man.

John.

You admitted yourself that he believes the EU is run by the Anti-Christ (second Roman empire, the beast, etc). The racism, well the fact that interracial marriages are not allowed says enough. The bigotry is connected right to that. Don't need to personally know the guy, his actions and publicly stated beliefs say enough about him and his church.

Michelle,
Ahh no, David C. Pack doesn't say the EU is run by the Anti-Christ! That's a terrible thing to say about such a lovely man!

No, instead he says the EU is "The Dragon", that gives its power to "The Beast", which is America and Britain. And lets be clear here, that's the Beast from the Sea, with the 7 heads and the 10 horns and a crown on each horn. As opposed to the Beast from the land with the 2 heads. No, the Anti-Christ just rides the back of The Beast and deceives millions, through its False Prophets, and gets everybody who is not written in the book of life to take the mark of the Beast on their right hand or forehead, and its the number of a man, and its number is 666. And the Vatican is the prostitute that sits on many waters and is dressed in Purple and Red, and is based in the city of 7 hills, which is Rome, which in the End Times, will be stripped nakid and left lying dead in the streets, and nobody will come to tend to the body. But they will write letters to each other saying how wonderful it is to see the prostitute is dead. And then for one hour, the 10 Kings will come together to concede their power to Jesus Christ as he is returning in the clouds.

At least get the story straight :)

John :)
35) Message boards : Politics : First Scientific Proof Of God Found (Message 1545202)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
No one can prove scientifically that God exists, but I would never try to convince anyone that he/she doesn't. The existence of God is purely a matter of faith. On the other hand I wish that people would quit trying to convince me and everyone else that shares my belief that no proof can be found, that there is logical proof of his/her existence.

Bob DeWoody,
Ahhhhh....common Bob, we have the proof. You of all people need to come on board! Us Christians need you!

John.
36) Message boards : Politics : First Scientific Proof Of God Found (Message 1545201)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
It makes me concerned for your mental well being, Johnney.

I wouldn't be too concerned about Johnney's sanity, he' been doing this stuff for years. He's Irish and claims the gift of gab or as others would say a lot of BS. He's just pulling your string and laughing.

betreger,
Ahhhh.... you saw straight through me. Ok, I give up the ball game. I was just pulling everyone's leg. I didn't find God after all. I just made it all up to get a reaction out of you guys! I had yea fooled for a while there!

John.
37) Message boards : Politics : First Scientific Proof Of God Found (Message 1545199)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:
It makes me concerned for your mental well being, Johnney.

Interesting you should say that. People get a pass from mental health professionals if their delusions are based on religion. They can be filled with an unseen spirit that makes them speak in a language that makes no sense. This spirit can also tell them what will happen in the future and they will not be diagnosed with a mental illness.

Batter Up,
The next time the guys in the white coats start chasing me through the park because i'm stark nakid and reading the Bible, I'm going to quote your words!

I'm going to say to the guys in the white coats;
"A guy called Batter up told me it was ok if I did it in the name of religion"

John :)
38) Message boards : Politics : First Scientific Proof Of God Found (Message 1545198)
Posted 21 Jul 2014 by Profile Johnney Guinness
Post:


Esme,
I give up? So what did you just read? Tell me what you thought? Its hard to decode the Ernie and Bart cartoon.

Good? Bad?, You loved it? Your hated it? You hate me? You think i'm a lunatic?

Tell me what you think of what I wrote Esme? I value your opinion more than others.

John.

It makes me concerned for your mental well being, Johnney.

Its a load of nonsense, to be honest. How it reads to me is that there are people who are not ready to let the bible go for the fiction that it is and who are now trying to make excuses for it.

The simplest explanation is often the correct one.

The bible is made up by people.

Esme,
Thank you for your honesty! I appreciate the feedback.

Yes, I too am concerned for my own well being. I'm going quite mad from the sheer quantity of religious and scientific research I have done in the last 8 years. I'm going mad because everyone seems to be telling lies, but claiming to have the truth! Doesn't matter what you read, everybody says they have the truth. But when you go and check it, its turns out to be lies.

Its a funny old world we live in.

John.
39) Message boards : Politics : First Scientific Proof Of God Found (Message 1545064)
Posted 20 Jul 2014 by Profile Johnney Guinness
Post:
I have my money on Bart Ehrman. He has done the research, and isn't teaching theology, but history.

What you claim as your research is the biggest pile of nonsense I have ever read.

That is my opinion.

Steve

Thank you Steve,
I actually appreciate your honesty. I'm glad you were straight up and honest with your opinion. It gives me more respect for you Steve.

I understand Steve. I agree, my research results do sound like a pile of science fiction nonsense. Buts its funny Steve, that rubbish I just spent an hour writing out for you is the revelation of God to mankind. They wrote it as science fiction, in your DNA code, and that is why no rational person believes it today. But they will in just a few years time. When its on the front cover of Nature magazine.

John.
40) Message boards : Politics : First Scientific Proof Of God Found (Message 1545059)
Posted 20 Jul 2014 by Profile Johnney Guinness
Post:


Esme,
I give up? So what did you just read? Tell me what you thought? Its hard to decode the Ernie and Bart cartoon.

Good? Bad?, You loved it? Your hated it? You hate me? You think i'm a lunatic?

Tell me what you think of what I wrote Esme? I value your opinion more than others.

John.


Previous 20 · Next 20


 
©2024 University of California
 
SETI@home and Astropulse are funded by grants from the National Science Foundation, NASA, and donations from SETI@home volunteers. AstroPulse is funded in part by the NSF through grant AST-0307956.