Posts by Johnney Guinness


log in
1) Message boards : Politics : First Scientific Proof Of God Found (Message 1550161)
Posted 12 hours ago by Profile Johnney Guinness
Johnney Guinness said: Its not just the Christian Bible that is in your DNA, also the whole of Greek History, Roman History, Jewish History, Arabic History, Chinese History, British history, German history, Japanese history, Korean history, they are all in there!! The history of every single nation on earth, written in your DNA, all written by God himself.

If this is true, you should have no problem correcting the egregious error in your original post by providing supporting information from a peer-reviewed scientific journal such as Cell or Nature.

Hi LanDroid,
The first post in this thread is a reference to an article on a spoof website. I didn't write the article, i'm just here discussing it.

And as I have said to many people here on these forums, i'm not an academic and I have never published any of my own work anywhere, except by posting it in messages on this forum.



Let's see if we can possibly sort out the contradictions between just a few quotes from Johnny Guiness.
1. Its NOT the word of "God", its words written by Flesh and blood human beings.
2. do you remember me posting a topic here before about Monks in a Monastery down in Israel a year or two ago, and I said that these people actually ARE God!!
3. Its the Monks in the Monasteries that created us!
4. Are you disappointed to find out in the end that you were created by God, the Lord of all Heaven and Earth?

Quote 1 says the Bible was written by cloistered humans, but quote 2 says these humans are God. Both can't be true.
Quote 3 says monks created humans, but quote 4 says God created everything. Oy.

LanDroid,
Yes, that is exactly what I am saying!! That is the very point that I am making, which is, that "God" actually is human beings. God actually is a group of "people". And those people, in effect, they reset the clock on humanity by creating a brand new "Adam and Eve" down in Iraq 6000 years ago! And they are still with us today. Monks who live in monistaries down in Israel "created" your ancestors and my ancestors, Adam and Eve, 6000 years ago. In short - "God" is "People", many of them, several million of them.



And today, I can't even finish reading the Book of Genesis, the first book in the Bible.

So how can you claim to know the Bible (let alone all the other histories listed above) is encoded in our DNA? (BTW, many people including myself have not been able to finish even the first book, but mainly because God is an extraordinarily bad writer: repetitive, turgid, contradictory, etc.)

Only someone that really wants to know about God will dive in deep into that book.

Obviously Johnney Guinness has no such desire since he hasn't read even 1/66th of it.

So I have a real problem reading books.

Sorry, but that is evident... You should seriously consider reading some brief articles on "confirmation bias" and "apophenia".

Anyway, thanks to all for a very entertaining thread! 8^ O


LanDroid,
I never said that I don't read the Bible. I do read the Bible, and I know the book quite well. I said that I haven't read "all of the Bible". I go into the Bible and read the bits I need to read. I read the parts of the Bible that are part of my research. But it doesn't mean that I have to read the full book to answer the questions that I needed answers to. In total, so far to date, I have read roughly about a quarter of the Bible. And as we speak, and over the coming months, I will be completing my first full reading of the entire book. But I don't actually need to read the whole entire Bible to complete my research. But I have set it as one of my goals to read the full book anyway.

The vast majority of my research is on "other books", not the Bible itself. And its these "other books" that led me to the conclusions I have posted in this thread.

John.
2) Message boards : Politics : First Scientific Proof Of God Found (Message 1548159)
Posted 4 days ago by Profile Johnney Guinness
Johnney.

It occurred to me that my son, Bubba, could help you along with your quest. He is very much attuned to the DNA thing. You maybe could find him in Santa Fe, New Mexico

Daddio,
I think your son Bubba should consider a change of career. Would he be interested in getting involved in the Shrimp business?



John.
3) Message boards : Politics : How I learned about God - David C. Pack (Message 1547038)
Posted 6 days ago by Profile Johnney Guinness
Well Mr Pack certainly doesn't seem to like modern preachers, even the Christians, seems they are all emissaries of the devil

Only managed 15 minutes, that was enough.

Oh well each to his own.

Bernie,
I agree with you. The man does have many flaws. If I take a completely impartial perspective on this, this would be the flaws I see;

1. He is quite overpowering, but in an American Preacher type of way. You would rarely see this type of preaching in Britain or Ireland, or Europe for that matter. But it seems to be quite common in America, in many American churches. Its a type of loud and boisterous preaching, and it can be very overpowering. I see this flaw in many American Preachers. Some people seem to like that type of loud Gospel Preaching.

2. Like you said Bernie, he does have a very high opinion of himself. He does believe that his particular church, the Restored Church of God, is more special than other Christian churches around the world. I see this as a pretty major flaw in David C. Pack.

3. On their Youtube channel, they have far too much focus on videos about the Book of Revelation. Now while the Book of Revelation is probably the most exciting and intriguing book in the whole Bible, I think they should spread their theme a bit wider and cover more of the other stuff in the Bible.

4. This is something that really bugs me about David C. Pack. He always ends his videos by saying "Good bye friends". He never ends his videos with a Christian blessing, or even a very simple "May God Bless you". No, he never does it. I really don't like that about the man, it troubles me.

But in saying all those things, the work he does to preach the Word of God, straight out of the Bible, and to explain the Bible in great detail, outweighs any flaws the man has. He is a good man, with flaws just like all the rest of us, but he is trying his best to spread the Christian message in a world that is increasingly trying to fight religion.

I commend the man for trying his best. He is solely responsible for bringing me back to God, after I had been an atheist for about 25 years. And because of that, I am very grateful to David C. Pack.

John.
4) Message boards : Politics : How I learned about God - David C. Pack (Message 1546958)
Posted 6 days ago by Profile Johnney Guinness
I'm glad we got everything sorted out, so in the mean time.....

Here is a great video by the Restored Church of God and David C. Pack.

Its called; Is the End Near?
https://www.youtube.com/watch?v=eJ_EZEwWfAQ (30 minutes long!)

In that video, David C. Pack discusses what the Bible says Through Jesus Christ's Revelation to Mankind about the End of the World. And when it will happen!

Enjoy!!

John.
5) Message boards : Politics : How I learned about God - David C. Pack (Message 1546827)
Posted 7 days ago by Profile Johnney Guinness
So Johnney, you're a cult member are you? :-O

Not a lot of good to be said about Packs on the internet you know, except for what's on RCG site, but I guess that you get that with a self confessed mad man running the show. ;-)

Cheers.

Yes Wiggo,
Anniet is trying to save my soul. She is teaching me about cults.

John.
6) Message boards : Team Recruitment Center : Join our team - - - PADDY'S IN SPACE - - - (Message 1546822)
Posted 7 days ago by Profile Johnney Guinness
Come and join our team PADDY'S IN SPACE. We would love to have you with us!

Join our team; Click here to join PADDY'S IN SPACE

PADDY'S IN SPACE team page at SETI@home; PADDY'S IN SPACE team page

PADDY'S IN SPACE team movie; Team movie on Youtube

PADDY'S IN SPACE website; www.paddysinspace.com

Paddy's and Ireland Proud winners of the SETI@home Gauntlet 4th-18th Nov 2007
7) Message boards : Politics : How I learned about God - David C. Pack (Message 1546809)
Posted 7 days ago by Profile Johnney Guinness
Anniet,

“Therefore keep watch, because you do not know the day or the hour."

Matthew 25:13 is David C. Packs favourite quote from the Bible. its in all his videos!

Just out of curiosity Johnney... does Mr Pack ever vary the inflection on the word "you"?

I said its one of David C. Packs favourite quotes from the Bible. He quotes it over and over again, because they are the words of Jesus Christ, through Jesus Christ's Revelation to mankind. No Anniet, he doesn't "inflect" the Biblical quote.

John... firstly - Not once did I say the date was promoted in Mr Pack's video's.

Yea right Anniet,
Great technicality. You only said David C. Pack was promoting particular dates for the end of the world. Yes, you didn't specifically say he was doing it in videos. Well done!!! [clap][clap][clap]. Aren't you great.

Quote Anniet;
....That is your prerogative and something I will not apologise for.


Quote Anniet;
I don't see why I should have to apologise for any of them, as I authored none of them.


I knew you wouldn't apologise. Its not in your nature to do so.

Anniet,
You have said some really terrible things about a lovely man, David C. Pack, that has dedicated his life to telling people about the Word of God.

Quote Anniet;
This could be... and this too.. Restored Church of God Members Deceived Into Thinking David C. Pack Never Set Any Dates. And as for his suspected involvement in events surrounding the death of a four year old girl and her mother's subsequent suicide attempt (and three other suicides that occurred during what has been called his "Reign of Terror" whilst serving his mentor Herbert Armstrong) detailed in the Ambassador Report... thay make for very disturbing reading.

Anniet,
You have implicated David C. Pack in the deaths of 5 people, one of them being a child. Now Anniet, that is a really terrible thing to do. That is just horrible Anniet.

There is something called the Law. If David C. Pack was involved in the deaths of 5 people, then the police will deal with it. If your worried about what you read on the so called "exit and support network" website you found on the internet Anniet, then you should telephone the police in Ohio and tell them about what you read on the internet. Your now a witness Anniet, and you should contact the police and report what you read on the internet. If a crime has been committed, the local police in Ohio will deal with it. This is a very serious thing you have done Anniet.

If the man has not committed any crime, then you should stand down Anniet and apologise for bearing false witness against your neighbour.

John.
8) Message boards : Politics : First Scientific Proof Of God Found (Message 1546543)
Posted 7 days ago by Profile Johnney Guinness
You know, we won't have to wait too long more before someone cracks the human genome code wide open.

In September 2012, the "ENCODE Project" published there most recent results and they categorised approximately 80% of the human genome as having a particular function. They published there results in Nature Journal. Read the Wikipedia page about it here;
http://en.wikipedia.org/wiki/ENCODE

That was 2 years ago that the ENCODE project published their results. Right now today, there are currently tens of thousands of hospitals, research institutes and universities carrying out genetics research. And they are all chasing the big prize - That is, to crack the code wide open. Nobel Prizes for the winners, so lots of scientists are chasing that prize!!

They are picking away at it, bit by bit, finding out what all the bits of code do in the human genome. And everybody is still puzzled by just how complex the whole thing really is. Its almost as complex as.......well......Its almost as complex as the Christian Bible! Hmmmmmm... could that be it? Never! Maybe?

But it will happen very quickly, all of a sudden, out of the blue, some clever guy will crack the code. He will figure out that there is a pattern to the whole thing. And he will figure out that you have to swap the letters around and you can read the code, just like you read a book.

We are very close now. We won't have to wait too long more. Then it will all be over. And everyone will know who and what God really is!! When you read the Bible, your reading part of the human genome. Your reading your own DNA code when you read the Bible! Jesus Christ is coming back real soon! Hold on tight, he's commin! Judgement Day, for all!! Biblical justice!

John-Paul.
9) Message boards : Politics : First Scientific Proof Of God Found (Message 1546525)
Posted 7 days ago by Profile Johnney Guinness
OK. Let me be a bit more direct. By understanding how the Bible got here and why, what it says, and how it contradicts itself, it makes decoding human DNA from such a questionable source, impossible except in your own mind.

Steve

Steve,
Ok so, then in your opinion i'm going to fail. Yep, thats fine, thanks for telling me.

John.
10) Message boards : Politics : First Scientific Proof Of God Found (Message 1546518)
Posted 7 days ago by Profile Johnney Guinness
As a matter of fact. One of my old Irish Girlfriends from 45 years ago married a Livermore scientist. Mary Agnes McMahon (Nee O'Brien). So call Frank McMahon at Livermore and tell him that you met a former admirer of his wife and see if he will help you out. I would venture to say that you can find other super computers as well. Probably some there in the Emerald Isle.

In the US 925-422-1100 is the main operator. I don't know if Frank still works there, but I still think that they live in Livermore California. I used to canoe on the lake there 30 years ago.

Thanks Daddio!

Its very unlikely that I will contact them. But thank you!

John.
11) Message boards : Politics : First Scientific Proof Of God Found (Message 1546514)
Posted 7 days ago by Profile Johnney Guinness
you need one of the hand-written originals


As I pointed out by linking you to Bart Ehrman's research, there are no original texts. Only copies of copies, and they were changing constantly.

I know you only looked at two minutes of each video, so you didn't get the evidence. This is true for both the old and new testaments. Bart looked at the oldest texts in existence, then the newer ones to develop a time line of what was added and when. Many times he can even explain why.

The Old Testament had at least 40 different authors, and was written over 1600 years. The new testament had thousands of authors, and evolved as church leaders tried to explain the inconsistencies and differences. It didn't even become a Bible until about 300 years after the time Jesus was alive.

There was so much evidence you passed up, because you only saw two minutes of each video, and decided you didn't like what you heard.

Steve

Steve,
I know that you are personally following a particular line of inquiry in your own Bible research. But Steve, i'm doing something very different to you, and its very different to Bart Ehrman. I tried to explain it to you, but I think you kind of breezed over the post I made and didn't really understand the importance of what I had written.

However, thank you Steve. Yes, I agree that Bart Ehrman's work is indeed very interesting. Its just different to what I am doing.

John.
12) Message boards : Politics : First Scientific Proof Of God Found (Message 1546499)
Posted 7 days ago by Profile Johnney Guinness
It sounds simple to just swap the letters around. But its actually quite difficult when you try.


Au Contraire' Mon Herr

It would be a cinch. A computer could run every possible substitution on, say, a sentence and then match it with a computerized copy of the bible or whatever you say is encoded. It would then quickly reject the many mismatches until it found that sentence intact. Then to verify your theory you would use the substitution that was successful on the next sentence and of course it would match as well if what you say is true. Todays supercomputers at Lawrence Livermore can do 1,000,000,000,000,000,000 instructions per second so it shouldn't take too long at all. It would be a rather simple program at that.

You of course would have to specify which language that you found this remarkable discovery.

Early accounts of the Bible were written in Greek. I presume you are talking about the New Testiment.

Daddio,
Therein lies the problem. Do you happen to have the phone number of Lawrence Livermore labs and I will just give them a quick call.

This is what I will say to them;
"Hi Guys. I was hanging out on an Extraterrestrial Alien hunting forum and I accidently found God. So would you guys mind if I use your billion dollar computer to search the human genome to see if I can find messages from God."

Yep, i'm pretty sure the guys at Lawrence Livermore Labs would just love to help me. Or more likely, they would try to put a straight-jacket on me and get me locked up.

John.
13) Message boards : Politics : First Scientific Proof Of God Found (Message 1546443)
Posted 7 days ago by Profile Johnney Guinness
Here's the amino-acid sequence for human insulin from the GenBank database. Can you show us how to convert this into the appropriate quote from the bible?

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Cheers.

Brendan,
Short answer - No, I can't. I cannot decode it. I need someone who is willing to work with me to help me extract the sequences. And so far, I haven't found anyone willing to help me.

I have a tonne of sequences already written out, by hand. But I lack the computer programming skills to know how to decode the stuff in reverse.

Its simple, but cracking the code is NOT simple. And you need to run the correct sequences, with NO spelling mistakes. And your only going to get them from ME!! I'm the only one who knows what sequences to search for. There is an inherent problem involved in cracking the code. And someone will have to "teach" you "how" to do it. You won't get it by pot-luck, or chancing your arm. You need to know the method, and its complex.

There are 20 amino acids, and 26 letters in the English alphabet. You have to know "how" they were writing the words down 2000 years ago, you MUST get an "original text". A modern printed bible in English is no good to you, you need one of the hand-written originals. 20 to the power of 26 is a massive number, its an astronomically large number. That is how many different possible letters you would have to swap around just to get one single letter in the right place. Then you have to repeat that 19 more times to get the full code.

It might look like this if you cracked the code;
Amino acid single letter abbreviation;
A, B, C, D, E, F, G......etc, etc, ... (Just a fictitious example)
What the Bible used;
W, N, E, M, B, R, T......etc, etc, ...(Just a fictitious example)

But of coarse, as I said, I haven't cracked the code YET! But i'm almost there.

It sounds simple to just swap the letters around. But its actually quite difficult when you try.

There is also another way to get the code. If you spend 10 years of your life becoming an expert in the old religious texts, the code is actually written out in one of the old books. But I don't know which book they wrote it out in. It might be coded into the Bible, or it might not, I don't know, i'm not a Bible expert. But I do have another book that I think has part of the code written out, but i'm still working on that book. The book is very old, and its difficult to read, and its not written in english.

John.
14) Message boards : Politics : How I learned about God - David C. Pack (Message 1546429)
Posted 7 days ago by Profile Johnney Guinness
Anniet,
Let me just save you some time and I can clarify this whole issue for you very quickly.

Anniet, the following is a typical video made by the Restored Church of God and David C. Pack.

Video name; December 21, 2012 is NOT the End of the World!
https://www.youtube.com/watch?v=v90IB-MPDUo (30 minutes long!)

It was a video made by the Restored Church of God and published on Youtube 3 months before the whole world-wide hype about the world ending in December 21st, 2012. In the video, David, C. Pack tries to teach Christians that they have absolutely nothing to worry about.

Anniet, you can watch the whole 30 minute video if you want, but I can save you some time.

Please fast forward the video to 8 minutes into it, just to save you time.
And just watch 1 minute 40 of the video. Watch from 8 minutes into the video to 9 minutes 40 seconds.

Anniet, what I want to highlight is what David C. Pack says at exactly 8 minutes 45 seconds into the video. At that point in the video David C. Pack quotes his favourite quote from the Bible, which is;

Matthew 25:13(NIV)
“Therefore keep watch, because you do not know the day or the hour."
https://www.biblegateway.com/passage/?search=Matthew+25%3A13&version=NIV

Now Anniet, like I said to you already, I have watched all 170 videos they have on Youtube. And the one thing that David C. Pack NEVER DOES is predict dates for the End of the World!

Anniet, he NEVER does it, never!! He never predicts dates of the End of the World, never, ever, ever. Why??? Answer, because he always, always, always quotes Matthew 25:13 and tells you the words of Jesus Christ, which are “Therefore keep watch, because you do not know the day or the hour."

Matthew 25:13 is David C. Packs favourite quote from the Bible. its in all his videos!

So Anniet, i'm quite sure that your not man (or woman) enough to apologise. I'm quite sure you will continue to stand you ground and you will continue to defend the propaganda website you linked to. That is probably your nature Anniet.

Makes me wonder why you read the Bible 4 or 5 times Anniet? You didn't seem to learn anything from reading it.

John.
15) Message boards : Politics : How I learned about God - David C. Pack (Message 1545949)
Posted 8 days ago by Profile Johnney Guinness
....

No matter. If you'd followed the links I posted it would have set your mind at rest as to the date being from Mr Pack himself (in a leaked member letter provided to the silenced website by someone who was once just like you - one of Mr Pack's followers - as are many who have contributed to the exit and support network). But as you don't give credence to internet sites (other than: youtube, the RCG website, and Witscience of course) your dismissal will I know, continue, so I won't belabour the point :)

The basis for some of his calculations I believe can be found here David C. Pack and the 3 ½ years It seems there is or was a mention in one of his mp3 audio file downloads, but with something like 450 of them to wade through, I have not tracked it down for you. I will take your word for it that he is not "promoting" it in his videos though. :) They are of course, harder to edit than the written word.

I do grant you that Mr Pack has not made the same quantity of prophetical gaffes as Ron Weinland of the RCG's sister church (or splinter group) the COG... whose most recently revised armageddon date (given from inside his prison cell) is Pentecost 2019 - which gives us all an extra three years! :)

I will and do defend the exit and support network though. It is not written as you say by "some spammer with a grudge".

This could be... and this too.. Restored Church of God Members Deceived Into Thinking David C. Pack Never Set Any Dates. And as for his suspected involvement in events surrounding the death of a four year old girl and her mother's subsequent suicide attempt (and three other suicides that occurred during what has been called his "Reign of Terror" whilst serving his mentor Herbert Armstrong) detailed in the Ambassador Report... thay make for very disturbing reading.

There are SO many more Johnney :( I do hope they're all wrong...

Anniet,
You were unable to give me a link to any video or webpage on a David C. Pack website, or a Restored Church of God website that states an exact date for the End of the World. So Anniet, I think I have proven my point!! Anniet, you posted a message stating as a matter of fact that David C. Pack was promoting a particular date for the End of the World. If he was Anniet, wouldn't you be able to find that webpage, or video, or book, or anything? Maybe i'm telling you the truth Anniet. Maybe he doesn't promote dates for the End of the World.

Anniet, have some dignity and stand down. Apologise for making false statements about he man. Your trying desperately to discredit a very nice man that tries his best to teach people the Bible. He tries his best Anniet, you could learn from him.

John.
16) Message boards : Politics : First Scientific Proof Of God Found (Message 1545473)
Posted 9 days ago by Profile Johnney Guinness
Batter Up,
The next time the guys in the white coats start chasing me through the park because i'm stark nakid and reading the Bible, I'm going to quote your words!


Not the words of Batter Up but the word of g-d.
Isaiah 20:2
... "Go and loosen the sackcloth from your hips and take your shoes off your feet." And he did so, going naked and barefoot.


Yep - Noah did a bit of that (Genesis 9:20-25) whilst he was drunk in Eve's womb I think.

Edit: THINK that's on topic...

anniet,
You said "drunk in Eve's womb"!

So at least somebody here is reading what I write. And remembering it.

Anniet, have I influenced your thinking at all, do you think?
While the things I say are a bit mad, do you think that, maybe, in a very theoretical world, there might be a tiny bit of truth in what I suggest?

John.
17) Message boards : Politics : First Scientific Proof Of God Found (Message 1545462)
Posted 9 days ago by Profile Johnney Guinness
Batter Up,
The next time the guys in the white coats start chasing me through the park because i'm stark nakid and reading the Bible, I'm going to quote your words!


Not the words of Batter Up but the word of g-d.
Isaiah 20:2
... "Go and loosen the sackcloth from your hips and take your shoes off your feet." And he did so, going naked and barefoot.

Batter Up,
That's a great biblical quote. I took a note of it for future reference! (In case the white coat men try to put the straight-jacket on me the next time :) )

Batter Up, can I ask you a question?
You seem to have a considerable knowledge of the Bible, do you read it?
Also;
I see you not writing the name of G-d. Only specific people do this Batter up. Somebody taught you to do that, and you obviously still do it? It shows a certain respect for religion. Or do you have another reason for doing it? http://www.jewfaq.org/name.htm

John.
18) Message boards : Politics : How I learned about God - David C. Pack (Message 1545450)
Posted 9 days ago by Profile Johnney Guinness
Sirius B,
What book did you read? Is it America & Britain in Prophesy? I'm ashamed to say, but I only got through about half the book. I only read the bit up until the point where David C. Pack explains how the thrown of King David passes through 3 Kingdoms.

I quit the book after that. That was the bit wanted to read. So I don't know what he said about the Eagle and the lion symbols.

Ah, so you cherry picked. Next time, try reading the whole book.

Sirius B,
Like I said, I only read the first half of the book. I just wanted to find out what he said about Ireland, and the High Kings of Ireland. I was just curious.

But you got to admit, its an interesting read! Gripping stuff!

John.
19) Message boards : Politics : How I learned about God - David C. Pack (Message 1545447)
Posted 9 days ago by Profile Johnney Guinness
Gee thanks Anniet, how can I ever repay you for saving me from the vicious religious cult that is run by a power hunger demon who just wants everybody's money?

You're welcome Johnney.

Have you a paypal account Anniet, I can forward you some cash to thank you.

No. I don't trust the internet :) and I'm not in the habit of taking money from anyone - gullible or not. Do I presume your rapid unconversion from Pack's teachings is why you didn't answer my question?

If September 27, 2016 passes by without a hitch - will you accept yet another revised doomsday date?

anniet,
The website is run by someone with a grudge against David C. Pack. so no, I don't trust a single word written on the website.

anniet show me a webpage, or a video, by David C. Pack, or the Restored Church of God, that says that he is promoting that date as the date for the end of the world.

anniet I have watched all 170 videos on there Youtube channel, and David C. Pack does not give dates for the End of the World in any single one of the videos. Not a single one Anniet! However - He does "discuss" the end of the world in many of the videos. He does what the Bible tells you to do. the "Bible" tells you the world is going to end. Its not David C. Pack, its the Bible says it!! David c. Pack is just reading exactly what the bible tells him to tell other people. He is telling people the Word of God.

Annite, show me a page in the RCG website where that date is listed as the date for the end of the world!

It doesn't matter if some spammer with a grudge wrote it some place else on the internet.

John.
20) Message boards : Politics : First Scientific Proof Of God Found (Message 1545440)
Posted 9 days ago by Profile Johnney Guinness
Because I bother to follow links that people post, I found this one on the Witscience site

Johnnie, are you sure that site is "for real" and you haven't been suckered in by a satire site ?

Liberalism Caused By Defective Chromosome

[edit] The author of this article is listed as Dr. Richter DasMeerungeheuer, which according to Google, translates as "Judge The sea monster" ??? [/edit]

T.A.

Terror Australis,
Yes, I agree with you, its a satire website! All the articles are complete rubbish.

But here is the thing - I opened this thread by linking to the article called "First Scientific Proof Of God Found", which is also written as satire.

But Terror Australis, its NOT satire. The article is different to the other articles on the website. Its intentional!!! And its not an accident that they put that article on a satirical website.

There is stuff in that article that they simply COULD NOT HAVE KNOWN!! They name specific genes, specifically they mention PYGB and Bmp3. Now Terror Australis, I know those genes don't mean anything to you. But I know exactly what they were talking about because I have been studying genetics for 4 years now. And they specifically tell you where to look for the sequence. They tell you its the verse from "1 Corinthians 6:19-20". They say stuff in the article that only someone with experience in genetic engineering could know.

All you need is a computer, a head for mathematics, and an interest in genetic engineering, and some time on your hands to go investigate!!

The Sanger Institute in Britain is one of the worlds foremost and respected scientific institute's carrying out genetics research. They have a copy of the human genome on their website, and its free for anyone to go and download and carry out research. https://www.sanger.ac.uk/

Terror Australis, I dare you!! Go and check it. Go and attempt to decode the sequences. But to do it, you will need a reasonable understanding of genetics and mathematics. All you got to do is swap around the letters of the amino acid code we use today, its that simple!! And out pops the Christian Bible from the human genome. But I warn you, it will take you a few months to get the code right! But you could get lucky and crack it sooner!

If you take the offer seriously, I will help you. I have tonnes of sequences already written out!

John.


Next 20

Copyright © 2014 University of California