First Scientific Proof Of God Found

Message boards : Politics : First Scientific Proof Of God Found
Message board moderation

To post messages, you must log in.

Previous · 1 . . . 11 · 12 · 13 · 14 · 15 · 16 · 17 · Next

AuthorMessage
Sirius B Project Donor
Volunteer tester
Avatar

Send message
Joined: 26 Dec 00
Posts: 24875
Credit: 3,081,182
RAC: 7
Ireland
Message 1545354 - Posted: 21 Jul 2014, 16:47:52 UTC - in response to Message 1545353.  

Walked right into that one :-(
ID: 1545354 · Report as offensive
Terror Australis
Volunteer tester

Send message
Joined: 14 Feb 04
Posts: 1817
Credit: 262,693,308
RAC: 44
Australia
Message 1545384 - Posted: 21 Jul 2014, 17:27:43 UTC
Last modified: 21 Jul 2014, 17:46:54 UTC

Because I bother to follow links that people post, I found this one on the Witscience site

Johnnie, are you sure that site is "for real" and you haven't been suckered in by a satire site ?

Liberalism Caused By Defective Chromosome

[edit] The author of this article is listed as Dr. Richter DasMeerungeheuer, which according to Google, translates as "Judge The sea monster" ??? [/edit]

T.A.
ID: 1545384 · Report as offensive
Terror Australis
Volunteer tester

Send message
Joined: 14 Feb 04
Posts: 1817
Credit: 262,693,308
RAC: 44
Australia
Message 1545388 - Posted: 21 Jul 2014, 17:30:28 UTC - in response to Message 1545353.  
Last modified: 21 Jul 2014, 17:32:26 UTC

The punch line of the story was, that when they finally decoded the sequence, it turned out to be a copyright notice. :)


I like it. Who held the copyright?

The intelligence behind the design.

Boom, Tish :D

BTW. In the story, the name of the copyright holder was not revealed. :)

T.A.
ID: 1545388 · Report as offensive
anniet
Volunteer tester
Avatar

Send message
Joined: 2 Feb 14
Posts: 7105
Credit: 1,577,368
RAC: 75
Zambia
Message 1545398 - Posted: 21 Jul 2014, 17:49:32 UTC - in response to Message 1545384.  
Last modified: 21 Jul 2014, 17:58:24 UTC

Because I bother to follow links that people post, I found this one on the Witscience site

Johnnie, are you sure that site is "for real" and you haven't been suckered in by a satire site ?

Liberalism Caused By Defective Chromosome

[edit] The author of this article is listed as Dr. Richter DasMeerungeheuer, which according to Google, translates as "Judge The sea monster" ??? [/edit]

T.A.


Yes! I googled him awhile back! Did you like their conclusive study on wind turbines slowing the earth's rotation? :)

edit: I googled the expert who wrote that, and came up with a stone that is not shiny (or something to that effect) :)
ID: 1545398 · Report as offensive
Profile Johnney Guinness
Volunteer tester
Avatar

Send message
Joined: 11 Sep 06
Posts: 3093
Credit: 2,652,287
RAC: 0
Ireland
Message 1545440 - Posted: 21 Jul 2014, 19:17:39 UTC - in response to Message 1545384.  
Last modified: 21 Jul 2014, 19:22:49 UTC

Because I bother to follow links that people post, I found this one on the Witscience site

Johnnie, are you sure that site is "for real" and you haven't been suckered in by a satire site ?

Liberalism Caused By Defective Chromosome

[edit] The author of this article is listed as Dr. Richter DasMeerungeheuer, which according to Google, translates as "Judge The sea monster" ??? [/edit]

T.A.

Terror Australis,
Yes, I agree with you, its a satire website! All the articles are complete rubbish.

But here is the thing - I opened this thread by linking to the article called "First Scientific Proof Of God Found", which is also written as satire.

But Terror Australis, its NOT satire. The article is different to the other articles on the website. Its intentional!!! And its not an accident that they put that article on a satirical website.

There is stuff in that article that they simply COULD NOT HAVE KNOWN!! They name specific genes, specifically they mention PYGB and Bmp3. Now Terror Australis, I know those genes don't mean anything to you. But I know exactly what they were talking about because I have been studying genetics for 4 years now. And they specifically tell you where to look for the sequence. They tell you its the verse from "1 Corinthians 6:19-20". They say stuff in the article that only someone with experience in genetic engineering could know.

All you need is a computer, a head for mathematics, and an interest in genetic engineering, and some time on your hands to go investigate!!

The Sanger Institute in Britain is one of the worlds foremost and respected scientific institute's carrying out genetics research. They have a copy of the human genome on their website, and its free for anyone to go and download and carry out research. https://www.sanger.ac.uk/

Terror Australis, I dare you!! Go and check it. Go and attempt to decode the sequences. But to do it, you will need a reasonable understanding of genetics and mathematics. All you got to do is swap around the letters of the amino acid code we use today, its that simple!! And out pops the Christian Bible from the human genome. But I warn you, it will take you a few months to get the code right! But you could get lucky and crack it sooner!

If you take the offer seriously, I will help you. I have tonnes of sequences already written out!

John.
ID: 1545440 · Report as offensive
Profile Johnney Guinness
Volunteer tester
Avatar

Send message
Joined: 11 Sep 06
Posts: 3093
Credit: 2,652,287
RAC: 0
Ireland
Message 1545462 - Posted: 21 Jul 2014, 20:04:10 UTC - in response to Message 1545269.  
Last modified: 21 Jul 2014, 20:09:24 UTC

Batter Up,
The next time the guys in the white coats start chasing me through the park because i'm stark nakid and reading the Bible, I'm going to quote your words!


Not the words of Batter Up but the word of g-d.
Isaiah 20:2
... "Go and loosen the sackcloth from your hips and take your shoes off your feet." And he did so, going naked and barefoot.

Batter Up,
That's a great biblical quote. I took a note of it for future reference! (In case the white coat men try to put the straight-jacket on me the next time :) )

Batter Up, can I ask you a question?
You seem to have a considerable knowledge of the Bible, do you read it?
Also;
I see you not writing the name of G-d. Only specific people do this Batter up. Somebody taught you to do that, and you obviously still do it? It shows a certain respect for religion. Or do you have another reason for doing it? http://www.jewfaq.org/name.htm

John.
ID: 1545462 · Report as offensive
Profile Johnney Guinness
Volunteer tester
Avatar

Send message
Joined: 11 Sep 06
Posts: 3093
Credit: 2,652,287
RAC: 0
Ireland
Message 1545473 - Posted: 21 Jul 2014, 20:21:00 UTC - in response to Message 1545271.  
Last modified: 21 Jul 2014, 20:23:33 UTC

Batter Up,
The next time the guys in the white coats start chasing me through the park because i'm stark nakid and reading the Bible, I'm going to quote your words!


Not the words of Batter Up but the word of g-d.
Isaiah 20:2
... "Go and loosen the sackcloth from your hips and take your shoes off your feet." And he did so, going naked and barefoot.


Yep - Noah did a bit of that (Genesis 9:20-25) whilst he was drunk in Eve's womb I think.

Edit: THINK that's on topic...

anniet,
You said "drunk in Eve's womb"!

So at least somebody here is reading what I write. And remembering it.

Anniet, have I influenced your thinking at all, do you think?
While the things I say are a bit mad, do you think that, maybe, in a very theoretical world, there might be a tiny bit of truth in what I suggest?

John.
ID: 1545473 · Report as offensive
Profile Julie
Volunteer moderator
Volunteer tester
Avatar

Send message
Joined: 28 Oct 09
Posts: 34041
Credit: 18,883,157
RAC: 18
Belgium
Message 1545778 - Posted: 22 Jul 2014, 10:17:28 UTC - in response to Message 1545353.  

The punch line of the story was, that when they finally decoded the sequence, it turned out to be a copyright notice. :)


I like it. Who held the copyright?

The intelligence behind the design.


You mean God?;)

@ Johnney: I understand what you're trying to explain here but I'd give up thinking anybody would really understand or is rather willing to understand you here. As I read before in this thread, quite an eccentric board here and everybody has his or her own ideas... Always nice to discuss thing in a civilized manner though, can't deny that...
rOZZ
Music
Pictures
ID: 1545778 · Report as offensive
Profile ML1
Volunteer moderator
Volunteer tester

Send message
Joined: 25 Nov 01
Posts: 20140
Credit: 7,508,002
RAC: 20
United Kingdom
Message 1545781 - Posted: 22 Jul 2014, 10:32:25 UTC - in response to Message 1545778.  

... I understand what you're trying to explain here but I'd give up thinking anybody would really understand or is rather willing to understand you here. As I read before in this thread, quite an eccentric board here and everybody has his or her own ideas... Always nice to discuss thing in a civilized manner though, can't deny that...

Fascinating to see how religions and conspiracy theories work!


And good fun for a good yarn...

Next: Philosophy? ;-)


Keep searchin',
Martin
See new freedom: Mageia Linux
Take a look for yourself: Linux Format
The Future is what We all make IT (GPLv3)
ID: 1545781 · Report as offensive
Profile Julie
Volunteer moderator
Volunteer tester
Avatar

Send message
Joined: 28 Oct 09
Posts: 34041
Credit: 18,883,157
RAC: 18
Belgium
Message 1545783 - Posted: 22 Jul 2014, 10:45:32 UTC

Next: Philosophy? ;-)


Ahhhh, philosophy... a subject that is worthy, to me, of some good and profound discussions!
rOZZ
Music
Pictures
ID: 1545783 · Report as offensive
anniet
Volunteer tester
Avatar

Send message
Joined: 2 Feb 14
Posts: 7105
Credit: 1,577,368
RAC: 75
Zambia
Message 1545822 - Posted: 22 Jul 2014, 12:59:08 UTC - in response to Message 1545473.  

anniet,
You said "drunk in Eve's womb"!

John! Hi :)

Well the bible says Noah was in a tent I think, but this is YOUR thread and we are discussing your theories, so "womb" seemed more apt in the circumstances, particularly as I was referring to a time after the flood had already washed him and the ark down Eve's fallopian tubes.

So at least somebody here is reading what I write. And remembering it.

I most certainly am remembering it :)

Anniet, have I influenced your thinking at all, do you think?

Well... I think you've convinced me more than ever that trying to make sense of a book written over a thousand years ago - and prove it's validity in anything other than an allegorical sense in our modern scientific world requires some very prolonged and tortuous thinking. I commend you on yours! :)

While the things I say are a bit mad, do you think that, maybe, in a very theoretical world, there might be a tiny bit of truth in what I suggest?

John.


I do think that what you are saying does seem a tad... off the wall... shall we say :) but then I have come to conclude the same about so much of the bible itself, that I don't see why your version should not also be out there for the whole world to know about either :)

John, I hope you don't mind me asking the following? I thought I had already seen it somewhere in one of your posts, but I haven't been able to find it. At which point in the bible does Eve give birth?

ps: sorry I haven't yet been able to answer your post in your other thread :( I hope to find some time to do so later today :)
ID: 1545822 · Report as offensive
Batter Up
Avatar

Send message
Joined: 5 May 99
Posts: 1946
Credit: 24,860,347
RAC: 0
United States
Message 1545914 - Posted: 22 Jul 2014, 15:11:52 UTC - in response to Message 1545822.  

At which point in the bible does Eve give birth?

Genesis 4
And Adam knew Eve his wife; and she conceived, and bare Cain, and said, I have gotten a man from Yahweh.
ID: 1545914 · Report as offensive
anniet
Volunteer tester
Avatar

Send message
Joined: 2 Feb 14
Posts: 7105
Credit: 1,577,368
RAC: 75
Zambia
Message 1545918 - Posted: 22 Jul 2014, 15:28:16 UTC - in response to Message 1545914.  
Last modified: 22 Jul 2014, 15:29:42 UTC

At which point in the bible does Eve give birth?

Genesis 4
And Adam knew Eve his wife; and she conceived, and bare Cain, and said, I have gotten a man from Yahweh.


That's what I thought! But... this IS Johnney's thread... :)
ID: 1545918 · Report as offensive
Batter Up
Avatar

Send message
Joined: 5 May 99
Posts: 1946
Credit: 24,860,347
RAC: 0
United States
Message 1545979 - Posted: 22 Jul 2014, 20:15:58 UTC - in response to Message 1545918.  

At which point in the bible does Eve give birth?

Genesis 4
And Adam knew Eve his wife; and she conceived, and bare Cain, and said, I have gotten a man from Yahweh.


That's what I thought! But... this IS Johnney's thread... :)
Oh sorry; you were testing him. Carry on.
ID: 1545979 · Report as offensive
Profile Julie
Volunteer moderator
Volunteer tester
Avatar

Send message
Joined: 28 Oct 09
Posts: 34041
Credit: 18,883,157
RAC: 18
Belgium
Message 1546041 - Posted: 22 Jul 2014, 21:34:39 UTC - in response to Message 1545979.  

At which point in the bible does Eve give birth?

Genesis 4
And Adam knew Eve his wife; and she conceived, and bare Cain, and said, I have gotten a man from Yahweh.


That's what I thought! But... this IS Johnney's thread... :)
Oh sorry; you were testing him. Carry on.



I don't think she was.
rOZZ
Music
Pictures
ID: 1546041 · Report as offensive
Sirius B Project Donor
Volunteer tester
Avatar

Send message
Joined: 26 Dec 00
Posts: 24875
Credit: 3,081,182
RAC: 7
Ireland
Message 1546050 - Posted: 22 Jul 2014, 21:45:02 UTC - in response to Message 1545914.  

At which point in the bible does Eve give birth?

Genesis 4
And Adam knew Eve his wife; and she conceived, and bare Cain, and said, I have gotten a man from Yahweh.


You mean god wanted to sample the forbidden fruit for himself?
ID: 1546050 · Report as offensive
Batter Up
Avatar

Send message
Joined: 5 May 99
Posts: 1946
Credit: 24,860,347
RAC: 0
United States
Message 1546078 - Posted: 22 Jul 2014, 23:10:09 UTC - in response to Message 1546050.  

At which point in the bible does Eve give birth?

Genesis 4
And Adam knew Eve his wife; and she conceived, and bare Cain, and said, I have gotten a man from Yahweh.


You mean god wanted to sample the forbidden fruit for himself?

It was most likely one of the Nephilim.

Genesis 6:4
The Nephilim were on the earth in those days, and also afterward, when the sons of G-d came in to the daughters of men, and they bore {children} to them. Those were the mighty men who {were} of old, men of renown.
- New American Standard Version (1995)

ID: 1546078 · Report as offensive
brendan
Avatar

Send message
Joined: 2 Sep 99
Posts: 165
Credit: 7,294,631
RAC: 0
United States
Message 1546339 - Posted: 23 Jul 2014, 13:28:53 UTC

Here's the amino-acid sequence for human insulin from the GenBank database. Can you show us how to convert this into the appropriate quote from the bible?

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Cheers.
ID: 1546339 · Report as offensive
Profile Johnney Guinness
Volunteer tester
Avatar

Send message
Joined: 11 Sep 06
Posts: 3093
Credit: 2,652,287
RAC: 0
Ireland
Message 1546443 - Posted: 23 Jul 2014, 18:57:38 UTC - in response to Message 1546339.  
Last modified: 23 Jul 2014, 19:51:37 UTC

Here's the amino-acid sequence for human insulin from the GenBank database. Can you show us how to convert this into the appropriate quote from the bible?

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Cheers.

Brendan,
Short answer - No, I can't. I cannot decode it. I need someone who is willing to work with me to help me extract the sequences. And so far, I haven't found anyone willing to help me.

I have a tonne of sequences already written out, by hand. But I lack the computer programming skills to know how to decode the stuff in reverse.

Its simple, but cracking the code is NOT simple. And you need to run the correct sequences, with NO spelling mistakes. And your only going to get them from ME!! I'm the only one who knows what sequences to search for. There is an inherent problem involved in cracking the code. And someone will have to "teach" you "how" to do it. You won't get it by pot-luck, or chancing your arm. You need to know the method, and its complex.

There are 20 amino acids, and 26 letters in the English alphabet. You have to know "how" they were writing the words down 2000 years ago, you MUST get an "original text". A modern printed bible in English is no good to you, you need one of the hand-written originals. 20 to the power of 26 is a massive number, its an astronomically large number. That is how many different possible letters you would have to swap around just to get one single letter in the right place. Then you have to repeat that 19 more times to get the full code.

It might look like this if you cracked the code;
Amino acid single letter abbreviation;
A, B, C, D, E, F, G......etc, etc, ... (Just a fictitious example)
What the Bible used;
W, N, E, M, B, R, T......etc, etc, ...(Just a fictitious example)

But of coarse, as I said, I haven't cracked the code YET! But i'm almost there.

It sounds simple to just swap the letters around. But its actually quite difficult when you try.

There is also another way to get the code. If you spend 10 years of your life becoming an expert in the old religious texts, the code is actually written out in one of the old books. But I don't know which book they wrote it out in. It might be coded into the Bible, or it might not, I don't know, i'm not a Bible expert. But I do have another book that I think has part of the code written out, but i'm still working on that book. The book is very old, and its difficult to read, and its not written in english.

John.
ID: 1546443 · Report as offensive
Profile William Rothamel
Avatar

Send message
Joined: 25 Oct 06
Posts: 3756
Credit: 1,999,735
RAC: 4
United States
Message 1546498 - Posted: 23 Jul 2014, 21:14:52 UTC - in response to Message 1546443.  
Last modified: 23 Jul 2014, 21:25:10 UTC

It sounds simple to just swap the letters around. But its actually quite difficult when you try.


Au Contraire' Mon Herr

It would be a cinch. A computer could run every possible substitution on, say, a sentence and then match it with a computerized copy of the bible, the human genome or whatever you say is encoded. It would then quickly reject the many mismatches until it found that sentence intact. Then to verify your theory you would use the substitution that was successful on the next sentence and of course it would match as well if what you say is true. Todays supercomputers at Lawrence Livermore can do 1,000,000,000,000,000,000 instructions per second so it shouldn't take too long at all. It would be a rather simple program at that.

You of course would have to specify in which language that you found this remarkable discovery.

Early accounts of the Bible were written in Greek. I presume you are talking about the New Testament.

There are only 3 billion pairs in the human genome so probably a random match of a long sentence might be possible but not the entire text.

As you can see my alter ego Daddio has also made significant breakthroughs in this important field.

ID: 1546498 · Report as offensive
Previous · 1 . . . 11 · 12 · 13 · 14 · 15 · 16 · 17 · Next

Message boards : Politics : First Scientific Proof Of God Found


 
©2024 University of California
 
SETI@home and Astropulse are funded by grants from the National Science Foundation, NASA, and donations from SETI@home volunteers. AstroPulse is funded in part by the NSF through grant AST-0307956.